Iright
BRAND / VENDOR: Proteintech

Proteintech, 16045-1-AP, PFDN4 Polyclonal antibody

CATALOG NUMBER: 16045-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PFDN4 (16045-1-AP) by Proteintech is a Polyclonal antibody targeting PFDN4 in WB, IHC, ELISA applications with reactivity to human samples 16045-1-AP targets PFDN4 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, Raji cells, THP-1 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The human PFDN4, prefoldin 4, is a subunit of the heterohexameric chaperone protein and belongs to the prefoldin family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. Previous reports have shown that PFDN4 is upregulated in breast cancer cell lines and tumor tissues (PMID: 11381030; PMID: 9630229). PFDN4 expression may be a prognostic factor in colorectal cancer (PMID: 20552408). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8938 Product name: Recombinant human PFDN4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-134 aa of BC010953 Sequence: MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES Predict reactive species Full Name: prefoldin subunit 4 Calculated Molecular Weight: 134 aa, 15 kDa Observed Molecular Weight: 15-20 kDa GenBank Accession Number: BC010953 Gene Symbol: PFDN4 Gene ID (NCBI): 5203 RRID: AB_2162573 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQP4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924