Iright
BRAND / VENDOR: Proteintech

Proteintech, 16046-1-AP, ALG5 Polyclonal antibody

CATALOG NUMBER: 16046-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ALG5 (16046-1-AP) by Proteintech is a Polyclonal antibody targeting ALG5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16046-1-AP targets ALG5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human kidney tissue, mouse liver tissue Positive IHC detected in: mouse liver tissue, human liver cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information Dolichyl-phosphate beta-glucosyltransferase(ALG5), belongs to the family of glycosyltransferases, specifically the hexosyltransferases. ALG5 is widely expressed in pancreas, placenta, liver, heart, brain, kidney, skeletal muscle, and lung. ALG5 can catalyze the chemical reaction between UDP-glucose and UDP with dolichyl phosphate. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8990 Product name: Recombinant human ALG5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 34-324 aa of BC012531 Sequence: MPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN Predict reactive species Full Name: asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae) Calculated Molecular Weight: 324 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC012531 Gene Symbol: ALG5 Gene ID (NCBI): 29880 RRID: AB_2273966 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y673 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924