Proteintech, 16051-1-AP, MYEF2 Polyclonal antibody

Size: 20ul / 150ul The MYEF2 (16051-1-AP) by Proteintech is a Polyclonal antibody targeting MYEF2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16051-1-AP targets MYEF2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, HepG2 cells, MCF-7 cells Positive IP detected in: Jurkat cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: C6 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9010 Product name: Recombinant human MYEF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-212 aa of BC014533 Sequence: MDGPGFGGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINRGFGDSFGRLGGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAEKACRIMNGIKISGREIDVRLDRNA Predict reactive species Full Name: myelin expression factor 2 Calculated Molecular Weight: 600 aa, 64 kDa Observed Molecular Weight: 61-64 kDa GenBank Accession Number: BC014533 Gene Symbol: MYEF2 Gene ID (NCBI): 50804 RRID: AB_2146869 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P2K5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.