Proteintech, 16062-1-AP, CYP39A1 Polyclonal antibody

Size: 20ul / 150ul The CYP39A1 (16062-1-AP) by Proteintech is a Polyclonal antibody targeting CYP39A1 in WB, IHC, ELISA applications with reactivity to human samples 16062-1-AP targets CYP39A1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells, SMMC-7721 cells Positive IHC detected in: human liver tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8896 Product name: Recombinant human CYP39A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-274 aa of BC010358 Sequence: FLLLQPKNLRRPPCIKGWIPWIGVGFEFGKAPLEFIEKARIKYGPIFTVFAMGNRMTFVTEEEGINVFLKSKKVDFELAVQNIVYRTASIPKNVFLALHEKLYIMLKGKMGTVNLHQFTGQLTEELHEQLENLGTHGTMDLNNLVRHLLYPVTVNMLFNKSLFSTNKKKIKEFHQYFQVYDEDFEYGSQLPECLLRNWSKSKKWFLELFEKNIPDIKACKSAKDNSMTLLQATLDIVETETSKENSPNYGLLLLWAS Predict reactive species Full Name: cytochrome P450, family 39, subfamily A, polypeptide 1 Calculated Molecular Weight: 469 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC010358 Gene Symbol: CYP39A1 Gene ID (NCBI): 51302 RRID: AB_2878211 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NYL5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.