Proteintech, 16072-1-AP, UBE2Q1 Polyclonal antibody

Size: 20ul / 150ul The UBE2Q1 (16072-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2Q1 in IP, ELISA applications with reactivity to human samples 16072-1-AP targets UBE2Q1 in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HEK-293 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9028 Product name: Recombinant human UBE2Q1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 258-422 aa of BC009286 Sequence: KELRDIYRSQSFKGGNYAVELVNDSLYDWNVKLLKVDQDSALHNDLQILKEKEGADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGGAICMELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKEDG Predict reactive species Full Name: ubiquitin-conjugating enzyme E2Q family member 1 Calculated Molecular Weight: 422 aa, 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC009286 Gene Symbol: UBE2Q1 Gene ID (NCBI): 55585 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z7E8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.