Proteintech, 16076-1-AP, XRCC6BP1 Polyclonal antibody

Size: 20ul / 150ul The XRCC6BP1 (16076-1-AP) by Proteintech is a Polyclonal antibody targeting XRCC6BP1 in WB, ELISA applications with reactivity to human samples 16076-1-AP targets XRCC6BP1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9042 Product name: Recombinant human XRCC6BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC012776 Sequence: MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI Predict reactive species Full Name: XRCC6 binding protein 1 Calculated Molecular Weight: 246 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC012776 Gene Symbol: XRCC6BP1 Gene ID (NCBI): 91419 RRID: AB_2878213 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6H3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.