Iright
BRAND / VENDOR: Proteintech

Proteintech, 16079-1-AP, RARS2 Polyclonal antibody

CATALOG NUMBER: 16079-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RARS2 (16079-1-AP) by Proteintech is a Polyclonal antibody targeting RARS2 in WB, ELISA applications with reactivity to human, mouse samples 16079-1-AP targets RARS2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HL-60 cells, human placenta tissue, mouse placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information RARS2 encodes the mitochondrial arginyl transfer RNA (tRNA) synthetase, an enzyme which belongs to the group of mitochondrial aminoacyl tRNA synthetases. These nuclear encoded mitochondrial proteins play a key role in mitochondrial protein translation by catalyzing the attachment of amino acids to their cognate tRNA molecules . Variants in RARS2 gene are associated with pontocerebellar hypoplasia type 6 (PCH6; MIM 611523), a rare mitochondrial encephalopathy with phenotype characterized by early onset seizures, profound developmental delay, and progressive pontocerebellar atrophy.(PMID: 27769281, PMID: 33209735) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9074 Product name: Recombinant human RARS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 230-578 aa of BC010420 Sequence: LELGDVQALSLWQKFRDLSIEEYIRVYKRLGVYFDEYSGESFYREKSQEVLKLLESKGLLLRTIKGTAVVDLSGNGDPSSICTVMRSDGTSLYATRDLAAAIDRMDKYNFDTMIYVTDKGQKKHFQQVFQMLKIMGYDWAERCQHVPFGVVQGMKTRRGDVTFLEDVLNEIQLRMLQNMASIKTTKELKNPQETAERVGLAALIIQDFKGLLLSDYKFSWDRVFQSRGDTGVFLQYTHARLHSLEETFGCGYLNDFNTACLQEPQSVSILQHLLRFDEVLYKSSQDFQPRHIVSYLLTLSHLAAVAHKTLQIKDSPPEVAGARLHLFKAVRSVLANGMKLLGITPVCRM Predict reactive species Full Name: arginyl-tRNA synthetase 2, mitochondrial Calculated Molecular Weight: 578 aa, 66 kDa Observed Molecular Weight: 66-70 kDa GenBank Accession Number: BC010420 Gene Symbol: RARS2 Gene ID (NCBI): 57038 RRID: AB_3669230 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5T160 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924