Iright
BRAND / VENDOR: Proteintech

Proteintech, 16084-1-AP, NUP160 Polyclonal antibody

CATALOG NUMBER: 16084-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NUP160 (16084-1-AP) by Proteintech is a Polyclonal antibody targeting NUP160 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 16084-1-AP targets NUP160 in WB, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human brain tissue Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9083 Product name: Recombinant human NUP160 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-190 aa of BC009822 Sequence: MAAAGALERSFVELSGAERERPRHFREFTVCSIGTANAVAGAVKYSESAGGFYYVESGKLFSVTRNRFIHWKTSGDTLELMEESLDINLLNNAIRLKFQNCSVLPGGVYVSETQNRVIILMLTNQTVHRLLLPHPSRMYRSVSWLSAISFISQITLGVTNVVLERCLLELKEIWILVIPHQAYFDSYRLK Predict reactive species Full Name: nucleoporin 160kDa Calculated Molecular Weight: 1316 aa, 149 kDa Observed Molecular Weight: 149 kDa GenBank Accession Number: BC009822 Gene Symbol: NUP160 Gene ID (NCBI): 23279 RRID: AB_2157341 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12769 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924