Iright
BRAND / VENDOR: Proteintech

Proteintech, 16105-1-AP, S100A4 Polyclonal antibody

CATALOG NUMBER: 16105-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The S100A4 (16105-1-AP) by Proteintech is a Polyclonal antibody targeting S100A4 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse samples 16105-1-AP targets S100A4 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, NIH/3T3 cells Positive IHC detected in: human breast cancer tissue, human pancreas cancer tissue, human colon cancer tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse spleen tissue, mouse lung tissue Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information S100A4 is a member of the S100 family of calcium-binding proteins. The S100 family members have been involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100A4 is known to localize to and function in the nucleus, cytoplasm of cells, and the extracellular space. S100A4 has also been shown to be associated with tumor growth, motility, invasion, metastasis, angiogenesis, apoptosis, and chemoresistance. It is a fibroblast-specific protein associated with mesenchymal cell morphology and motility, is expressed during epithelial-mesenchymal transformations (EMT) in vivo (PMID: 9362334). It is a specific prognostic marker for renal survival in patients with IgAN (PMID: 16105038). It is also an improved marker for lung fibroblasts that could be useful for investigating the pathogenesis of pulmonary fibrosis(PMID: 15618458). Overexpression of S100A4 is correlated with a worse prognosis inpatients with various types of cancer. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9019 Product name: Recombinant human S100A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-101 aa of BC016300 Sequence: MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK Predict reactive species Full Name: S100 calcium binding protein A4 Calculated Molecular Weight: 101 aa, 12 kDa Observed Molecular Weight: 10-12 kDa GenBank Accession Number: BC016300 Gene Symbol: S100A4 Gene ID (NCBI): 6275 ENSEMBL Gene ID: ENSG00000196154 RRID: AB_11042591 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P26447 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924