Iright
BRAND / VENDOR: Proteintech

Proteintech, 16133-1-AP, MUL1 Polyclonal antibody

CATALOG NUMBER: 16133-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MUL1 (16133-1-AP) by Proteintech is a Polyclonal antibody targeting MUL1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16133-1-AP targets MUL1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Mitochondrial ubiquitin ligase 1 (MUL1),MAPL, MULAN, or gGIDE, was identified as an E3 protein ligase by three independent groups. Work in mammalian systems shows that MUL1 has small ubiquitin-like modifier (SUMO) ligase activity, stabilizing Drp1, or ubiquitin ligase activity, degrading Mfn. MUL1 expression in mammalian cells results in smaller and more fragmented mitochondria. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9119 Product name: Recombinant human MUL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-239 aa of BC010101 Sequence: SVYRQKARVSQELKGAKKVHLGEDLKSILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRL Predict reactive species Full Name: mitochondrial E3 ubiquitin ligase 1 Calculated Molecular Weight: 352 aa, 40 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC010101 Gene Symbol: MUL1 Gene ID (NCBI): 79594 RRID: AB_2147111 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q969V5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924