Iright
BRAND / VENDOR: Proteintech

Proteintech, 16146-1-AP, LYPLAL1 Polyclonal antibody

CATALOG NUMBER: 16146-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LYPLAL1 (16146-1-AP) by Proteintech is a Polyclonal antibody targeting LYPLAL1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16146-1-AP targets LYPLAL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells Positive IHC detected in: human liver cancer tissue, mouse kidney tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Lysophospholipase-like 1 protein, encoded by LYPLAL1, a 26 kDa cytosol protein which belongs to a subclass of lysophospholipase family. Human genome-wide association studies link variants of the gene encoding this enzyme to fat distribution, waist-to-hip ratio and non-alcoholic fatty liver disease. LYPLAL1 reported to be up-regulated in subcutaneous adipose tissue of obese individuals.(PMID: 25958046, PMID: 27391855, PMID: 21674055) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9271 Product name: Recombinant human LYPLAL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-237 aa of BC016711 Sequence: MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK Predict reactive species Full Name: lysophospholipase-like 1 Calculated Molecular Weight: 237 aa, 26 kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: BC016711 Gene Symbol: LYPLAL1 Gene ID (NCBI): 127018 RRID: AB_2138521 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VWZ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924