Proteintech, 16218-1-AP, ZNF446 Polyclonal antibody

Size: 20ul / 150ul The ZNF446 (16218-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF446 in WB, IF/ICC, ELISA applications with reactivity to human samples 16218-1-AP targets ZNF446 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SH-SY5Y cells Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9266 Product name: Recombinant human ZNF446 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-422 aa of BC017206 Sequence: EQFLGTLPPEIQAWVRGQRPGSPEEAAALVEGLQHDPGQLLGWITAHVLKQEVLPAAQKTEEPLGSPHPSGTVESPGEGPQDTRIEGSVQLSCSVKEEPNVDGQEVAPSSPPLAAQSPEGHHGHQEPASTSFHPPRIQEEWGLLDRSQKELYWDAMLEKYGTVVSLGLPPHQPEAQAQSELGMLLTGTGVCRSLRSGNESEGPPGCPEAQPPQGPGPAAWEGLSGAATPAPTVRPGTPPVPTQPTPAETRLEPAATPRKPYTCEQCGRGFDWKSVFVIHHRTHTSGPGVQSPGLATGESTEKPPQGEVAFPHHPRHSLTGPRSYPCEECGCSFSWKSQLVIHRKSHRPEVP Predict reactive species Full Name: zinc finger protein 446 Calculated Molecular Weight: 422 aa, 46 kDa Observed Molecular Weight: 49-55 kDa GenBank Accession Number: BC017206 Gene Symbol: ZNF446 Gene ID (NCBI): 55663 RRID: AB_2878231 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NWS9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.