Proteintech, 16221-1-AP, LDHAL6A Polyclonal antibody

Size: 20ul / 150ul The LDHAL6A (16221-1-AP) by Proteintech is a Polyclonal antibody targeting LDHAL6A in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16221-1-AP targets LDHAL6A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, human brain tissue, Jurkat cells, mouse brain tissue, mouse testis tissue Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9273 Product name: Recombinant human LDHAL6A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC014340 Sequence: MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKGETMDLQHGSPFMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLMIPNITQYSPHCKLLIVTNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGIHSESCHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKK Predict reactive species Full Name: lactate dehydrogenase A-like 6A Calculated Molecular Weight: 26 kDa, 37 kDa Observed Molecular Weight: 30-36 kDa GenBank Accession Number: BC014340 Gene Symbol: LDHAL6A Gene ID (NCBI): 160287 RRID: AB_2265629 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZMR3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.