Iright
BRAND / VENDOR: Proteintech

Proteintech, 16221-1-AP, LDHAL6A Polyclonal antibody

CATALOG NUMBER: 16221-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LDHAL6A (16221-1-AP) by Proteintech is a Polyclonal antibody targeting LDHAL6A in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16221-1-AP targets LDHAL6A in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, human brain tissue, Jurkat cells, mouse brain tissue, mouse testis tissue Positive IF/ICC detected in: Hela cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9273 Product name: Recombinant human LDHAL6A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-234 aa of BC014340 Sequence: MATIKSELIKNFAEEEAIHHNKISIVGTGSVGVACAISILLKGLSDELVLVDVDEGKLKGETMDLQHGSPFMKMPNIVSSKDYLVTANSNLVIITAGARQKKGETRLDLVQRNVSIFKLMIPNITQYSPHCKLLIVTNPVDILTYVAWKLSGFPKNRVIGSGCNLDSARFRYFIGQRLGIHSESCHGLILGEHGDSSVPVWSGVNIAGVPLKDLNPDIGTDKDPEQWENVHKKK Predict reactive species Full Name: lactate dehydrogenase A-like 6A Calculated Molecular Weight: 26 kDa, 37 kDa Observed Molecular Weight: 30-36 kDa GenBank Accession Number: BC014340 Gene Symbol: LDHAL6A Gene ID (NCBI): 160287 RRID: AB_2265629 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZMR3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924