Proteintech, 16233-1-AP, VIP Polyclonal antibody

Size: 20ul / 150ul The VIP (16233-1-AP) by Proteintech is a Polyclonal antibody targeting VIP in IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 16233-1-AP targets VIP in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human colon tissue, rat small intestine tissue, mouse brain tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse colon tissue Positive IF/ICC detected in: HT-29 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Vasoactive intestinal peptide (VIP), a short peptide containing 28 amino acids belonging to the secretin-glucagon family, is initially isolated from the gastrointestinal tract as a potent vasodilator peptide. VIP was initially identified in normal nervous tissue and neurons and was subsequently recognized as a neurotransmitter widely distributed in various tissues. The wide distribution of VIP determines its involvement in a range of biological activities, such as gut motility, hormonal regulation, circadian rhythms, immune responses, and carcinogenesis. The general physiologic effects of VIP include vasodilation, anti-inflammatory actions, cell proliferation, hormonal secretion, regulation of gastric motility, and smooth muscle relaxation; therefore, VIP has emerged as a promising drug candidate for the treatment of several diseases. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8933 Product name: Recombinant human VIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-169 aa of BC009794 Sequence: YRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK Predict reactive species Full Name: vasoactive intestinal peptide Calculated Molecular Weight: 169 aa, 19 kDa GenBank Accession Number: BC009794 Gene Symbol: VIP Gene ID (NCBI): 7432 RRID: AB_2878233 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01282 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.