Proteintech, 16235-1-AP, MRPS18A Polyclonal antibody

Size: 20ul / 150ul The MRPS18A (16235-1-AP) by Proteintech is a Polyclonal antibody targeting MRPS18A in WB, IHC, ELISA applications with reactivity to human samples 16235-1-AP targets MRPS18A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, L02 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MRPS18A (Mitochondrial Ribosomal Protein S18A) is a protein coding gene. It encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The increased expression of MRPS18A in cancer cells is explained by the increased energy metabolism of cancer cells and may pave the way for new diagnostic and therapeutic avenues to be explored (PMID: 28056857). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8981 Product name: Recombinant human MRPS18A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-196 aa of BC010364 Sequence: MAALKALVSGCGRLLRGLLAGPAATSWSRLPARGFREVVETQEGKTTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH Predict reactive species Full Name: mitochondrial ribosomal protein S18A Calculated Molecular Weight: 196 aa, 22 kDa Observed Molecular Weight: 18-22 kDa GenBank Accession Number: BC010364 Gene Symbol: MRPS18A Gene ID (NCBI): 55168 RRID: AB_2266663 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVS2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.