Iright
BRAND / VENDOR: Proteintech

Proteintech, 16238-1-AP, WRNIP1 Polyclonal antibody

CATALOG NUMBER: 16238-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WRNIP1 (16238-1-AP) by Proteintech is a Polyclonal antibody targeting WRNIP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 16238-1-AP targets WRNIP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human colon tissue, human kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Human WRN-interacting protein 1 (WRNIP1) is a genome maintenance factor. Functions as a modulator of initiation or reinitiation events during DNA polymerase delta-mediated DNA synthesis. In the presence of ATP, stimulation of DNA polymerase delta-mediated DNA synthesis is decreased. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9040 Product name: Recombinant human WRNIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 293-640 aa of BC018923 Sequence: VTLSATNAKTNDVRDVIKQAQNEKSFFKRKTILFIDEIHRFNKSQQVNAALLSRCRVIVLEKLPVEAMVTILMRAINSLGIHVLDSSRPTDPLSHSSNSSSEPAMFIEDKAVDTLAYLSDGDARAGLNGLQLAVLARLSSRKMFCKKSGQSYSPSRVLITENDVKEGLQRSHILYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFASEDIGLADPSALTQAVAAYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLRNHQGPLPPVPLHLRNAPTRLMKDLGYGKGYKYNPMYSEPVDQEYLPEELRGVDFFKQRRC Predict reactive species Full Name: Werner helicase interacting protein 1 Calculated Molecular Weight: 665aa,72 kDa; 640aa,69 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC018923 Gene Symbol: WRNIP1 Gene ID (NCBI): 56897 RRID: AB_2288535 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96S55 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924