Proteintech, 16261-1-AP, HTN3 Polyclonal antibody

Size: 20ul / 150ul The HTN3 (16261-1-AP) by Proteintech is a Polyclonal antibody targeting HTN3 in WB, ELISA applications with reactivity to human samples 16261-1-AP targets HTN3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Histatins are a family of salivary proteins that have antibacterial properties. HTN3, also known as Histatin-3, is an important saliva component and a major precursor for forming the enamel film on the tooth surface. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9302 Product name: Recombinant human HTN3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-51 aa of BC009791 Sequence: MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN Predict reactive species Full Name: histatin 3 Calculated Molecular Weight: 51 aa, 6 kDa Observed Molecular Weight: 6-7 kDa GenBank Accession Number: BC009791 Gene Symbol: HTN3 Gene ID (NCBI): 3347 RRID: AB_3669234 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15516 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.