Proteintech, 16264-1-AP, PQBP1 Polyclonal antibody

Size: 20ul / 150ul The PQBP1 (16264-1-AP) by Proteintech is a Polyclonal antibody targeting PQBP1 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16264-1-AP targets PQBP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, mouse brain tissue, mouse skeletal muscle tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human breast cancer tissue, human colon tissue, mouse colon tissue, rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PQBP1 (Polyglutamine-binding protein 1) is also named as NPW38 and JM26. PQBP1 senses extrinsic tau 3R/4R proteins by direct interaction and triggers an innate immune response by activating a cyclic GMP-AMP synthase (cGAS)-Stimulator of interferon genes (STING) pathway (PMID: 34782623).  PQBP1 is abundantly expressed in the central nervous system during development. PQBP1 is a component of the precatalytic spliceosome (B complex) that is involved in splicing. PQBP1 was predominantly localized in the cell nucleus. PQBP1 is overexpressed in various cancer types including breast cancer, colon cancer, and glioblastoma (PMID: 38342602). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9329 Product name: Recombinant human PQBP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-265 aa of BC012358 Sequence: MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSCGLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRSHEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHRREELAPYPKSKKAVSRKDEELDPMDPSSYSDAPRGTWSTGLPKRNEAKTGADTTAAGPLFQQRPYPSPGAVLRANAEASRTKQQD Predict reactive species Full Name: polyglutamine binding protein 1 Calculated Molecular Weight: 265 aa, 30 kDa Observed Molecular Weight: 30-32 kDa GenBank Accession Number: BC012358 Gene Symbol: PQBP1 Gene ID (NCBI): 10084 RRID: AB_10792928 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60828 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.