Iright
BRAND / VENDOR: Proteintech

Proteintech, 16294-1-AP, SPAG7 Polyclonal antibody

CATALOG NUMBER: 16294-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPAG7 (16294-1-AP) by Proteintech is a Polyclonal antibody targeting SPAG7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16294-1-AP targets SPAG7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse ovary tissue, mouse brain tissue, mouse skeletal muscle tissue, rat brain tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information SPAG7 encodes the sperm-associated antigen 7, which is widely expressed. The SPAG7 protein contains two nuclear localisation signals and a R3H domain. The domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner. This might indicate a potential role of the protein in response to viruses or free DNAs or RNAs. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9471 Product name: Recombinant human SPAG7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-227 aa of BC011934 Sequence: MADLLGSILSSMEKPPSLGDQETRRKAREQAARLKKLQEQEKQQKVEFRKRMEKEVSDFIQDSGQIKKKFQPMNKIERSILHDVVEVAGLTSFSFGEDDDCRYVMIFKKEFAPSDEELDSYRRGEEWDPQKAEEKRKLKELAQRQEEEAAQQGPVVVSPASDYKDKYSHLIGKGAAKDAAHMLQANKTYGCVPVANKRDTRSIEEAMNEIRAKKRLRQSGEELPPTS Predict reactive species Full Name: sperm associated antigen 7 Calculated Molecular Weight: 227 aa, 26 kDa Observed Molecular Weight: 26-31 kDa GenBank Accession Number: BC011934 Gene Symbol: SPAG7 Gene ID (NCBI): 9552 RRID: AB_2302478 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75391 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924