Proteintech, 16302-1-AP, Claudin 15 Polyclonal antibody

Size: 20ul / 150ul The Claudin 15 (16302-1-AP) by Proteintech is a Polyclonal antibody targeting Claudin 15 in WB, ELISA applications with reactivity to human, mouse, rat samples 16302-1-AP targets Claudin 15 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, mouse small intestine tissue, rat colon tissue, rat small intestine tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Claudins are a family of proteins that are the most important components of tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 23 claudins have been identified. They are small (20-27 kilodalton (kDa)) proteins with very similar structure. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Claudin family member Claudin-15 is a classic tight junction molecule. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9124 Product name: Recombinant human CLDN15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC010160 Sequence: MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLALSGSTDSPASLSGGTGLLVRLMSIKGPCEGRRLASCRLSVRCKEAVCVQGIFRPAGHS Predict reactive species Full Name: claudin 15 Calculated Molecular Weight: 128aa,14 kDa; 228aa,24 kDa Observed Molecular Weight: 24-26 kDa GenBank Accession Number: BC010160 Gene Symbol: Claudin 15 Gene ID (NCBI): 24146 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56746 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.