Iright
BRAND / VENDOR: Proteintech

Proteintech, 16304-1-AP, CHAC2 Polyclonal antibody

CATALOG NUMBER: 16304-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHAC2 (16304-1-AP) by Proteintech is a Polyclonal antibody targeting CHAC2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16304-1-AP targets CHAC2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, Raji cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CHAC2 is a gamma-glutamyl cyclotransferase that catalyzes the conversion of glutathione to 5-oxoproline and cysteinylglycine. CHAC2 is involved in continuous, basal turnover of cytosolic glutathione(PMID: 27913623). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9281 Product name: Recombinant human CHAC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-184 aa of BC019239 Sequence: MWVFGYGSLIWKVDFPYQDKLVGYITNYSRRFWQGSTDHRGVPGKPGRVVTLVEDPAGCVWGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFSVLLYIGTCDNPDYLGPAPLEDIAEQIFNAAGPSGRNTEYLFELANSIRNLVPEEADEHLFALEKLVKERLEGKQNLNCI Predict reactive species Full Name: ChaC, cation transport regulator homolog 2 (E. coli) Calculated Molecular Weight: 184 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC019239 Gene Symbol: CHAC2 Gene ID (NCBI): 494143 RRID: AB_2229405 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WUX2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924