Iright
BRAND / VENDOR: Proteintech

Proteintech, 16331-1-AP, OCTN2 Polyclonal antibody

CATALOG NUMBER: 16331-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OCTN2 (16331-1-AP) by Proteintech is a Polyclonal antibody targeting OCTN2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 16331-1-AP targets OCTN2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse small intestine tissue, mouse skeletal muscle tissue, human placenta tissue, mouse pancreas tissue, mouse testis tissue Positive IP detected in: mouse skeletal muscle tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information OCTN2 (Organic Cation/Carnitine Transporter 2), encoded by SLC22A5, is a ubiquitously expressed organic anion/cation transporter. OCTN2 plays a key role in absorption, tissue distribution and renal reabsorption of L-carnitine which is an essential cofactor in fat metabolism. Defects in the OCTN2 are responsible for primary carnitine deficiency. OCTN2 also transports some important respiratory medicines (such as tiotropium), and due to its expression in the lung, may influence the disposition and absorption of these medicines in the lung. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9450 Product name: Recombinant human SLC22A5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-142 aa of BC012325 Sequence: MRDYDEVTAFLGEWGPFQRLIFFLLSASIIPNGFTGLSSVFLIATPEHRCRVPDAANLSSAWRNHTVPLRLRDGREVPHSCRRYRLATIANFSALGLEPGRDVDLGQLEQESCPDGWEFSQDVYLSTIVTEWNLVCEDDWKA Predict reactive species Full Name: solute carrier family 22 (organic cation/carnitine transporter), member 5 Calculated Molecular Weight: 557 aa, 63 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC012325 Gene Symbol: OCTN2 Gene ID (NCBI): 6584 RRID: AB_2191406 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O76082 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924