Iright
BRAND / VENDOR: Proteintech

Proteintech, 16337-1-AP, CD157 Polyclonal antibody

CATALOG NUMBER: 16337-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD157 (16337-1-AP) by Proteintech is a Polyclonal antibody targeting CD157 in WB, IHC, ELISA applications with reactivity to human samples 16337-1-AP targets CD157 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, RAW 264.7 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information BST-1(bone marrow stromal cell antigen 1), also named as CD157 or ADP-ribosyl cyclase 2, is a glycosyl phosphotidylinositol-anchored protein that stimulates pre-B-cell growth and has adenosine diphosphate (ADP)-ribosyl cyclase and cyclic ADP-ribose (cADPR) hydrolase activity (PMID: 9473467, 11866528). The two enzymatic activities are responsible for the synthesis and hydrolysis of cADPR, a novel second messenger of calcium release from intracellular calcium stores. BST-1 has a calculated molecular mass of 30-36 kDa and an apparent molecular mass of 40-46 kDa due to the glycosylation (PMID: 8941363, 10491089). Specification Tested Reactivity: human Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9491 Product name: Recombinant human BST1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-318 aa of BC012095 Sequence: SAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL Predict reactive species Full Name: bone marrow stromal cell antigen 1 Calculated Molecular Weight: 318 aa, 36 kDa Observed Molecular Weight: 39-46 kDa GenBank Accession Number: BC012095 Gene Symbol: CD157 Gene ID (NCBI): 683 RRID: AB_2878244 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q10588 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924