Proteintech, 16347-1-AP, PAH Polyclonal antibody

Size: 20ul / 150ul The PAH (16347-1-AP) by Proteintech is a Polyclonal antibody targeting PAH in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16347-1-AP targets PAH in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, HepG2 cells, mouse liver tissue, rat liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PAH, also known as PH, belongs to the aromatic amino acid hydroxylase (AAAH) enzyme family. PAH catalyzes the conversion of L-phenylalanine (L-Phe) to L-tyrosine (L-Tyr) by para-hydroxylation of the aromatic side chain. PAH is primarily present in the liver, where removal of excess L-Phe prevents the neurotoxic effect of hyperphenylalaninemia (HPA). (PMID: 23457044) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9541 Product name: Recombinant human PAH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 177-452 aa of BC026251 Sequence: VEYMEEGKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKIK Predict reactive species Full Name: phenylalanine hydroxylase Calculated Molecular Weight: 452 aa, 52 kDa Observed Molecular Weight: 45-52 kDa GenBank Accession Number: BC026251 Gene Symbol: PAH Gene ID (NCBI): 5053 RRID: AB_2878247 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00439 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.