Proteintech, 16355-1-AP, CYP2C9 Polyclonal antibody

Size: 20ul / 150ul The CYP2C9 (16355-1-AP) by Proteintech is a Polyclonal antibody targeting CYP2C9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16355-1-AP targets CYP2C9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, SMMC-7721 cells, rat liver tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information CYP2C9 (Cytochrome P450 Family 2 Subfamily C Member 9) is a crucial cytochrome P450 enzyme, which plays a significant role in the metabolism, by oxidation, of both xenobiotic and endogenous compounds. CYP2C9 is primarily expressed in the liver, and the expression level is reported to be the second highest among CYP isoforms(PMID: 20150829). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9566 Product name: Recombinant human CYP2C9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-162 aa of BC020754 Sequence: MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGG Predict reactive species Full Name: cytochrome P450, family 2, subfamily C, polypeptide 9 Calculated Molecular Weight: 162aa,18 kDa; 490aa,56 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC020754 Gene Symbol: CYP2C9 Gene ID (NCBI): 1559 RRID: AB_3085487 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11712 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.