Iright
BRAND / VENDOR: Proteintech

Proteintech, 16397-1-AP, SMAD9 Polyclonal antibody

CATALOG NUMBER: 16397-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SMAD9 (16397-1-AP) by Proteintech is a Polyclonal antibody targeting SMAD9 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16397-1-AP targets SMAD9 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, HEK-293 cells, HepG2 cells, mouse lung tissue Positive IHC detected in: human prostate cancer tissue, human urothelial carcinoma tissue, mouse heart tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SMAD9 (also known as MADH9 or MAD homolog 9) is a key signaling molecule in the transforming growth factor-β (TGF-β) superfamily signaling pathway and belongs to the SMAD1/5/9 subgroup of receptor-regulated SMADs (R-SMADs). It is primarily activated and phosphorylated by BMP (bone morphogenetic protein) type I receptors. Once activated, SMAD9 forms a complex with the common SMAD4 (Co-SMAD), translocates into the nucleus, and acts as a transcription factor to regulate the expression of specific target genes. This process is involved in modulating a variety of critical biological processes, including cell proliferation, differentiation, apoptosis, and embryonic development. Mutations or abnormal expression of SMAD9 are associated with several diseases, particularly in pulmonary arterial hypertension, certain cancers, and vascular diseases, where it plays a significant role. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9490 Product name: Recombinant human SMAD9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-352 aa of BC011559 Sequence: MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQL Predict reactive species Full Name: SMAD family member 9 Calculated Molecular Weight: 430 aa, 49 kDa Observed Molecular Weight: 49-55 kDa GenBank Accession Number: BC011559 Gene Symbol: SMAD9 Gene ID (NCBI): 4093 RRID: AB_2270847 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O15198 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924