Iright
BRAND / VENDOR: Proteintech

Proteintech, 16403-1-AP, POLR2J Polyclonal antibody

CATALOG NUMBER: 16403-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The POLR2J (16403-1-AP) by Proteintech is a Polyclonal antibody targeting POLR2J in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16403-1-AP targets POLR2J in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, human brain tissue, HeLa cells, MCF-7 cells Positive IP detected in: A549 cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9520 Product name: Recombinant human POLR2J protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC024165 Sequence: MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEG Predict reactive species Full Name: polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa Calculated Molecular Weight: 115 aa, 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC024165 Gene Symbol: POLR2J Gene ID (NCBI): 5439 RRID: AB_10666162 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P52435 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924