Iright
BRAND / VENDOR: Proteintech

Proteintech, 16434-1-AP, IMMP1L Polyclonal antibody

CATALOG NUMBER: 16434-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IMMP1L (16434-1-AP) by Proteintech is a Polyclonal antibody targeting IMMP1L in WB, ELISA applications with reactivity to human, mouse, rat samples 16434-1-AP targets IMMP1L in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information IMMP1L, a member of the peptidase S26 family, catalyzes the removal of transport peptides that target proteins from the mitochondrial matrix, across the inner membrane, and into the intermembrane space.IMMP1L is localized on the Mitochondrion inner membrane. Heterodimer of 2 subunits, IMMPL1 and IMMPL2 (PMID: 26341627; 28337252). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9747 Product name: Recombinant human IMMP1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC023595 Sequence: MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD Predict reactive species Full Name: IMP1 inner mitochondrial membrane peptidase-like (S. cerevisiae) Calculated Molecular Weight: 166 aa, 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC023595 Gene Symbol: IMMP1L Gene ID (NCBI): 196294 RRID: AB_2923562 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96LU5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924