Proteintech, 16441-1-AP, Histone H2A.z Polyclonal antibody

Size: 20ul / 150ul The Histone H2A 16441-1-AP targets Histone H2A.z in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human brain tissue, mouse kidney tissue Positive IHC detected in: human skin cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, fish, oratosquilla oratoria Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9762 Product name: Recombinant human Histone H2A.z protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC018002 Sequence: MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV Predict reactive species Full Name: H2A histone family, member Z Calculated Molecular Weight: 128 aa, 14 kDa Observed Molecular Weight: 14 kDa GenBank Accession Number: BC018002 Gene Symbol: Histone H2A.z Gene ID (NCBI): 3015 RRID: AB_2115113 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P0C0S5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.