Proteintech, 16449-1-AP, AGXT2L2 Polyclonal antibody

Size: 20ul / 150ul The AGXT2L2 (16449-1-AP) by Proteintech is a Polyclonal antibody targeting AGXT2L2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16449-1-AP targets AGXT2L2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information AGXT2L2, also known as alanine-glyoxylate aminotransferase 2-like 2 or PHYKPL (5-phosphohydroxy-L-lysine phospho-lyase), is a nuclear gene encoding a mitochondrial enzyme. It belongs to the class-III pyridoxal phosphate-dependent aminotransferase family and shares approximately 36% sequence identity with AGXT2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8391 Product name: Recombinant human AGXT2L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 276-450 aa of BC008009 Sequence: MGKSIGNGHPVACVAATQPVARAFEATGVEYFNTFGGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDVRGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLDNARQVVAKLDAILTDMEEKVRSCETLRLQP Predict reactive species Full Name: alanine-glyoxylate aminotransferase 2-like 2 Calculated Molecular Weight: 450aa,50 kDa; 175aa,19 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC008009 Gene Symbol: AGXT2L2 Gene ID (NCBI): 85007 RRID: AB_2225868 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IUZ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.