Iright
BRAND / VENDOR: Proteintech

Proteintech, 16454-1-AP, AP3D1 Polyclonal antibody

CATALOG NUMBER: 16454-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AP3D1 (16454-1-AP) by Proteintech is a Polyclonal antibody targeting AP3D1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16454-1-AP targets AP3D1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, NIH/3T3 cells, HepG2 cells Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP3D1 is a subunit of the AP-3 complex which is composed of two large adaptins (AP3D1 and AP3B1 or AP3B2), a medium adaptin (AP3M1 or AP3M2) and a small adaptin (APS1 or AP3S2). AP-3 complex is associated with the Golgi region as well as more peripheral structures. It facilitates the budding of vesicles from the Golgi membrane and may be directly involved in trafficking to lysosomes. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9390 Product name: Recombinant human AP3D1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC010065 Sequence: MALKMVKGSIDRMFDKNLQDLVRGIRNHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQMLGYDISWAAFNIIEVMSASKFTFKRIGYLAASQSFHEGTDVIMLTTNQIRKDLSSPSQYDTGVALTGLSCFVTPDLARDLANDIMTLMSHTKPYIRKKAVLIMYKVFLKYPESLRPAFPRLKEKLEDPDPGVQSAAVNVICELARRNPKNYLSLAPLFFKLMTSSTNNWVLIKIIKLFGALTPLGPRLGKKLIEPLTNLIHSTSAMSLLYECVNTVIAVLISLSSGMPNHSASIQLCVQKLRILIEDSDQNLKYLGLLAMSKILKTHPKSVQSHKDLILQCLDD Predict reactive species Full Name: adaptor-related protein complex 3, delta 1 subunit Calculated Molecular Weight: 1153 aa, 130 kDa Observed Molecular Weight: 110 kDa GenBank Accession Number: BC010065 Gene Symbol: AP3D1 Gene ID (NCBI): 8943 RRID: AB_10596951 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14617 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924