Iright
BRAND / VENDOR: Proteintech

Proteintech, 16465-1-AP, HGD Polyclonal antibody

CATALOG NUMBER: 16465-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HGD (16465-1-AP) by Proteintech is a Polyclonal antibody targeting HGD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16465-1-AP targets HGD in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells, rat liver tissue, mouse liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Homogentisate1,2-dioxygenase (HGD), also named as HGO, is a mononuclear Fe(II)-dependent oxygenase that catalyzes the third step in the pathway for the catabolism of tyrosine, the conversion of homogentisate (HG) to maleylacetoacetate (MAA) and it can exsit as a dimer or trimer(PMID:14678794). HGD consists of a single type of subunit with no intermolecular disulfide bridges and requires Fe2+ as a cofactor(PMID: 7705358). Defects in HGD are the cause of alkaptonuria (AKU)(PMID:10594001). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9544 Product name: Recombinant human HGD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-329 aa of BC020792 Sequence: MAELKYISGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTALRRPARSSWHLRGLPMAPWHLCLNHL Predict reactive species Full Name: homogentisate 1,2-dioxygenase (homogentisate oxidase) Calculated Molecular Weight: 37 kDa, 50 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC020792 Gene Symbol: HGD Gene ID (NCBI): 3081 RRID: AB_2248397 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q93099 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924