Iright
BRAND / VENDOR: Proteintech

Proteintech, 16466-1-AP, DPEP2 Polyclonal antibody

CATALOG NUMBER: 16466-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DPEP2 (16466-1-AP) by Proteintech is a Polyclonal antibody targeting DPEP2 in IHC, ELISA applications with reactivity to human, mouse, rat samples 16466-1-AP targets DPEP2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information DPEP2(Dipeptidase 2) may play an important role in the regulation of leukotriene activity which converts leukotriene d4 to leukotriene e4. It belongs to the peptidase M19 family. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 53 kDa and 44 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9545 Product name: Recombinant human DPEP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-379 aa of BC024021 Sequence: CAYTTPGPPRAQFWSAYVPCQTQDRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILRTFYMLGVRYLTLTHTCNTPWAESSAKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIFSHSAARGVCNSARNVPDDILQLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGGDYDGAGKFPQGLEDVSTYPVLIEELLSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVSESS Predict reactive species Full Name: dipeptidase 2 Calculated Molecular Weight: 399 aa, 44 kDa Observed Molecular Weight: 45 kDa, 50 kDa GenBank Accession Number: BC024021 Gene Symbol: DPEP2 Gene ID (NCBI): 64174 RRID: AB_11232414 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H4A9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924