Iright
BRAND / VENDOR: Proteintech

Proteintech, 16470-1-AP, PCSK5 Polyclonal antibody

CATALOG NUMBER: 16470-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PCSK5 (16470-1-AP) by Proteintech is a Polyclonal antibody targeting PCSK5 in IHC, ELISA applications with reactivity to human, mouse samples 16470-1-AP targets PCSK5 in IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human kidney tissue, human brain tissue, human skin tissue, human heart tissue, human testis tissue, human spleen tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PC5 ,a mammalian kex2-like processing endoprotease, mediates posttranslational endoproteolytic processing for several integrin alpha subunits.It has been identified in rat and mouse endocrine and neuroendocrine tissues,and is encoded by multiple mRNAs that generate two splice variant isoforms referred to as PC5A (102KDa) and PC5B (207KDa) .PC5A is smaller than PC5B and it can be processed into two forms (117 kDa and 65 kDa) in neuronal cells(PMID:11457520). Specification Tested Reactivity: human, mouse Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9552 Product name: Recombinant human PC5 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 32-351 aa of BC012064 Sequence: TRVYTNHWAVKIAGGFPEANRIASKYGFINIGQIGALKDYYHFYHSRTIKRSVISSRGTHSFISMEPKVEWIQQQVVKKRTKRDYDFSRAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERTHPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSFNPQHVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEEC Predict reactive species Full Name: proprotein convertase subtilisin/kexin type 5 Calculated Molecular Weight: 102 kDa, 207 kDa Observed Molecular Weight: 210 kDa GenBank Accession Number: BC012064 Gene Symbol: PCSK5 Gene ID (NCBI): 5125 RRID: AB_2283381 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92824 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924