Proteintech, 16480-1-AP, NDUFA4L2 Polyclonal antibody

Size: 20ul / 150ul The NDUFA4L2 (16480-1-AP) by Proteintech is a Polyclonal antibody targeting NDUFA4L2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 16480-1-AP targets NDUFA4L2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, HeLa cells, HUVEC cells, HepG2 cells, Jurkat clells, PC-3 cells Positive IP detected in: HeLa cells Positive IHC detected in: human liver cancer tissue, human kidney tissue, human liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NDUFA4L2(NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2), also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria and belongs to the complex I NDUFA4 subunit family. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9600 Product name: Recombinant human NDUFA4L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC011910 Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 Calculated Molecular Weight: 87 aa, 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC011910 Gene Symbol: NDUFA4L2 Gene ID (NCBI): 56901 RRID: AB_2150637 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRX3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.