Proteintech, 16482-1-AP, BTN2A2 Polyclonal antibody

Size: 20ul / 150ul The BTN2A2 (16482-1-AP) by Proteintech is a Polyclonal antibody targeting BTN2A2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 16482-1-AP targets BTN2A2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF7 cells, NIH/3T3 cells, MCF-7 cells, human testis tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Butyrophilins constitute a family of transmembrane proteins consisting of butyrophilin (BTN), BTN-like (BTNL), and selection and upkeep of intraepithelial T cell (SKI NT) proteins. It has been reported that BTN2A2 is expressed on B cells, DCs, and macrophages and the expression levels are upregulated upon activation. BTN2A2 is also expressed on thymic epithelial cells (TECs). The BTN2A2 putative receptor is expressed on activated T cells. BTN2A2 protein inhibits T cell proliferation, metabolism and Th1 cytokine production(PMID: 34588505). The calculated MW of BTN2A2 is 59kDa, and the glycosylated form is around 65kDa (PMID:20208008). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9603 Product name: Recombinant human BTN2A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 281-523 aa of BC014021 Sequence: VSICCIKKLQREKKILSGEKKVEQEEKEIAQQLQEELRWRRTFLHAADVVLDPDTAHPELFLSEDRRSVRRGPYRQRVPDNPERFDSQPCVLGWESFASGKHYWEVEVENVMVWTVGVCRHSVERKGEVLLIPQNGFWTLEMFGNQYRALSSPERILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPRSAFTVPVRPFFRLGSDDSPIFICPALTGASGVMVPEEGLKLHRVGTHQSL Predict reactive species Full Name: butyrophilin, subfamily 2, member A2 Calculated Molecular Weight: 523 aa, 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: BC014021 Gene Symbol: BTN2A2 Gene ID (NCBI): 10385 RRID: AB_2228110 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVV5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.