Iright
BRAND / VENDOR: Proteintech

Proteintech, 16485-1-AP, CDC25C Polyclonal antibody

CATALOG NUMBER: 16485-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CDC25C (16485-1-AP) by Proteintech is a Polyclonal antibody targeting CDC25C in WB, IHC, IP, ELISA applications with reactivity to human samples 16485-1-AP targets CDC25C in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, Raji cells, HeLa cells, HepG2 cells, K-562 cells Positive IP detected in: K-562 cells Positive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The cell division cycle 25 (CDC25) family of proteins are highly conserved dual specificity phosphatases that activate cyclin-dependent kinase (CDK) complexes, which in turn regulate progression through the cell division cycle. CDC25C(cell division cycle 25 homolog C) is one of the 3 isoforms of CDC25 in mammalian cells. It is present in the cytoplasm of asynchronously growing human cells(PMID:10330186). And it may be phosphorylated by its own substrate, an active cdc2-cyclin B complex, to create an autoactivation loop(PMID:7937793). It can be hyperphosphorylated to get the active form of 70 kDa(PMID:18296513). CDC25C has some isofroms with molecular mass of 46-53 kDa. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9607 Product name: Recombinant human CDC25C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-279 aa of BC019089 Sequence: MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANLSILSGGTPKCCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMKCSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNPNLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDKVKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQ Predict reactive species Full Name: cell division cycle 25 homolog C (S. pombe) Calculated Molecular Weight: 473 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC019089 Gene Symbol: CDC25C Gene ID (NCBI): 995 RRID: AB_2291330 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P30307 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924