Proteintech, 16500-1-AP, BTF3L4 Polyclonal antibody

Size: 20ul / 150ul The BTF3L4 (16500-1-AP) by Proteintech is a Polyclonal antibody targeting BTF3L4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16500-1-AP targets BTF3L4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293T cells, Jurkat cells Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9666 Product name: Recombinant human BTF3L4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-158 aa of BC022371 Sequence: MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMIKDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQFPRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN Predict reactive species Full Name: basic transcription factor 3-like 4 Calculated Molecular Weight: 158 aa, 17 kDa Observed Molecular Weight: 17-20 kDa GenBank Accession Number: BC022371 Gene Symbol: BTF3L4 Gene ID (NCBI): 91408 RRID: AB_2878265 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96K17 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.