Proteintech, 16512-1-AP, HSP10 Polyclonal antibody

Size: 20ul / 150ul The HSP10 (16512-1-AP) by Proteintech is a Polyclonal antibody targeting HSP10 in WB, IHC, ELISA applications with reactivity to human, mouse samples 16512-1-AP targets HSP10 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 Positive IHC detected in: human lung cancer tissue, mouse adrenal gland tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: human, mouse Cited Reactivity: chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9732 Product name: Recombinant human HSPE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC023518 Sequence: MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD Predict reactive species Full Name: heat shock 10kDa protein 1 (chaperonin 10) Calculated Molecular Weight: 102 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC023518 Gene Symbol: HSP10 Gene ID (NCBI): 3336 RRID: AB_3085493 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P61604 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.