Iright
BRAND / VENDOR: Proteintech

Proteintech, 16530-1-AP, APOC4 Polyclonal antibody

CATALOG NUMBER: 16530-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The APOC4 (16530-1-AP) by Proteintech is a Polyclonal antibody targeting APOC4 in WB, IF/ICC, ELISA applications with reactivity to human samples 16530-1-AP targets APOC4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9780 Product name: Recombinant human APOC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-127 aa of BC020723 Sequence: ACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG Predict reactive species Full Name: apolipoprotein C-IV Calculated Molecular Weight: 127 aa, 15 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC020723 Gene Symbol: APOC4 Gene ID (NCBI): 346 RRID: AB_2878271 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P55056 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924