Iright
BRAND / VENDOR: Proteintech

Proteintech, 16534-1-AP, CTHRC1 Polyclonal antibody

CATALOG NUMBER: 16534-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CTHRC1 (16534-1-AP) by Proteintech is a Polyclonal antibody targeting CTHRC1 in WB, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 16534-1-AP targets CTHRC1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, A375 cells, Jurkat cells, mouse lung tissue, rat brain tissue Positive IP detected in: A375 cells Positive IF/ICC detected in: A375 cells, HepG2 cells Positive FC (Intra) detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.13 ug per 10^6 cells in a 100 µl suspension Background Information Collagen triple helix repeat-containing protein 1 (CTHRC1), also known as protein NMTC1, is a glycosylated secreted protein. CTHRC1 was identified as a novel molecular in injured and diseased arteries where it may contribute to vascular remodeling by limiting collagen matrix deposition and promoting cell migration (PMID: 15618538). It has been reported that CTHRC1 is a positive regulator of osteoblastic bone formation (PMID: 18779865). Besides, studies reveal that CTHRC1 expression is implicated in various malignancies, including hepatocellular carcinoma, gastric carcinoma, colon cancer, and lung cancer (PMID: 23922981; 24504172; 24746208; 25139095). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9812 Product name: Recombinant human CTHRC1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-243 aa of BC014245 Sequence: MRPQGPAASPQRLRGLLLLLLLQLPAPSSASEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK Predict reactive species Full Name: collagen triple helix repeat containing 1 Calculated Molecular Weight: 243 aa, 26 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC014245 Gene Symbol: CTHRC1 Gene ID (NCBI): 115908 RRID: AB_2087511 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96CG8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924