Iright
BRAND / VENDOR: Proteintech

Proteintech, 16542-1-AP, CRYGS Polyclonal antibody

CATALOG NUMBER: 16542-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRYGS (16542-1-AP) by Proteintech is a Polyclonal antibody targeting CRYGS in WB, ELISA applications with reactivity to human, rat samples 16542-1-AP targets CRYGS in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat eye tissue Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Background Information CRYGS (Gamma-S crystallin), also called CRYG8, belongs to the gamma-crystallins (PMID: 7733876; 23199295). Three major classes of crystallins, alpha, beta, and gamma, are common to the eye lens throughout all vertebrates. The beta and gamma classes are made up of homologous proteins and constitute the beta/gamma crystallin superfamily. CRYGS is expressed late but abundantly in the ocular lens (PMID: 1445197). It is also expressed outside the lens, particularly in the mature retina and cornea. In contrast to the beta-crystallins which associate in various combinations to form low or high molecular weight aggregates, CRYGS is, like the other gamma-crystallins, a monomeric protein (PMID: 16141006). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9868 Product name: Recombinant human CRYGS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-178 aa of BC070241 Sequence: MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE Predict reactive species Full Name: crystallin, gamma S Calculated Molecular Weight: 178 aa, 21 kDa Observed Molecular Weight: 21 kDa GenBank Accession Number: BC070241 Gene Symbol: CRYGS Gene ID (NCBI): 1427 RRID: AB_3669249 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P22914 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924