Proteintech, 16546-1-AP, CYP2C8/9/18/19 Polyclonal antibody

Size: 20ul / 150ul The CYP2C8/9/18/19 (16546-1-AP) by Proteintech is a Polyclonal antibody targeting CYP2C8/9/18/19 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16546-1-AP targets CYP2C8/9/18/19 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, rat liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information CYP2C8(Cytochrome P450 2C8) is also named as CYPIIC8, cytochrome P450 IIC2, cytochrome P450 MP-12, cytochrome P450 MP-20, cytochrome P450 form 1 and S-mephenytoin 4-hydroxylase. It belongs to the cytochrome P450 family. It is a monooxygenase involved in an NADPH-dependent electron transport pathway and a hepatic drug-metabolizing enzymes that oxidizes therapeutic drugs such as cerivastatin and endobiotics such as retinoic acid and arachidonic acid. It has 2 isoforms produced by alternative splicing. This antibody can recognize human CYP2C 8/9/18/19, mouse CYP2C 29/37/38/39/55/65/, rat CYP2C6/7/11/12/13/23 due to the high homology. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9898 Product name: Recombinant human CYP2C8 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 142-490 aa of BC020596 Sequence: EDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV Predict reactive species Full Name: cytochrome P450, family 2, subfamily C, polypeptide 8 Calculated Molecular Weight: 490 aa, 56 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC020596 Gene Symbol: CYP2C8 Gene ID (NCBI): 1558 RRID: AB_2089685 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10632 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.