Proteintech, 16555-1-AP, SPG11 Polyclonal antibody

Size: 20ul / 150ul The SPG11 (16555-1-AP) by Proteintech is a Polyclonal antibody targeting SPG11 in IHC, ELISA applications with reactivity to human, mouse, rat samples 16555-1-AP targets SPG11 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9769 Product name: Recombinant human SPG11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 133-482 aa of BC024161 Sequence: TLVGMKLLDKISSVPHGELSCTTELLILAHHCFTLTCHMEGIIRVLQAAHMLTDNHLAPSEEYGLVVRLLTGIGRYNEMTYIFDLLHKKHYFEVLMRKKLDPSGTLKTALLDYIKRCRPGDSEKHNMIALCFSMCREIGENHEAAARIQLKLIESQPWEDSLKDGHQLKQLLLKALTLMLDAAESYAKDSCVRQAQHCQRLTKLITLQIHFLNTGQNTMLINLGRHKLMDCILALPRFYQASIVAEAYDFVPDWAEILYQQVILKGDFNYLEEFKQQRLLKSSIFEEISKKYKQHQPTDMVMENLKKLLTYCEDVYLYYKLAYEHKFYEIVNVLLKDPQTGCCLKDMLAG Predict reactive species Full Name: spastic paraplegia 11 (autosomal recessive) Calculated Molecular Weight: 2443 aa, 279 kDa GenBank Accession Number: BC024161 Gene Symbol: SPG11 Gene ID (NCBI): 80208 RRID: AB_2878277 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96JI7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.