Proteintech, 16592-1-AP, BATF2 Polyclonal antibody

Size: 20ul / 150ul The BATF2 (16592-1-AP) by Proteintech is a Polyclonal antibody targeting BATF2 in IP, ELISA applications with reactivity to human samples 16592-1-AP targets BATF2 in WB, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HeLa cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9551 Product name: Recombinant human BATF2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-189 aa of BC012330 Sequence: MDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQLELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASHTGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREHKPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF Predict reactive species Full Name: basic leucine zipper transcription factor, ATF-like 2 Calculated Molecular Weight: 29 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC012330 Gene Symbol: BATF2 Gene ID (NCBI): 116071 RRID: AB_2878285 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N1L9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.