Iright
BRAND / VENDOR: Proteintech

Proteintech, 16620-1-AP, INTS3 Polyclonal antibody

CATALOG NUMBER: 16620-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The INTS3 (16620-1-AP) by Proteintech is a Polyclonal antibody targeting INTS3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 16620-1-AP targets INTS3 in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, mouse testis tissue, rat testis tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:200-1:1000 Background Information INTS3 is a member of the integrator complex characterised as an RNA polymerase II (RNAPII) C-terminal domain binding factor involved in the processing of small nuclear RNAs (snRNAs) (PMID: 16239144). INTS3 was overexpressed in colorectal cancer (CRC) patients and tumour cell lines and inhibited CRC apoptosis by promoting the degradation of pro-apoptotic gene transcripts (PMID: 38665208). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9917 Product name: Recombinant human INTS3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 91-445 aa of BC025254 Sequence: YHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLLIKNNSLPRKRQSLRSSSSKLAQLTLEQILEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAALSSPRSRKNATQPPNAEEESGSSSASEEEDTKPKPTKRKRKGSSAVGSDSD Predict reactive species Full Name: integrator complex subunit 3 Calculated Molecular Weight: 118 kDa Observed Molecular Weight: 118 kDa GenBank Accession Number: BC025254 Gene Symbol: INTS3 Gene ID (NCBI): 65123 RRID: AB_2127274 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q68E01 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924