Iright
BRAND / VENDOR: Proteintech

Proteintech, 16621-1-AP, TMLHE Polyclonal antibody

CATALOG NUMBER: 16621-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMLHE (16621-1-AP) by Proteintech is a Polyclonal antibody targeting TMLHE in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16621-1-AP targets TMLHE in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human liver tissue, rat kidney tissue, Jurkat cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Trimethyllysine dioxygenase (TMLHE) encodes the first enzyme in carnitine biosynthesis, N6-trimethyllysine dioxygenase (TMLD) and enzyme deficiency was suggested to be a risk factor for ASD. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rabbit Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9919 Product name: Recombinant human TMLHE protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-376 aa of BC025269 Sequence: MWYHRLSHLHSRLQDLLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLTCAWQQHEDHFELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETTLFFTWPDGHVTKYDLNWLVKNSYEGQKQKVIQPRILWNAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQCDIPERILTYRHFVSGTSIEHRGSLI Predict reactive species Full Name: trimethyllysine hydroxylase, epsilon Calculated Molecular Weight: 376 aa, 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC025269 Gene Symbol: TMLHE Gene ID (NCBI): 55217 RRID: AB_2205303 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVH6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924