Iright
BRAND / VENDOR: Proteintech

Proteintech, 16627-1-AP, CRTAM/CD355 Polyclonal antibody

CATALOG NUMBER: 16627-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRTAM/CD355 (16627-1-AP) by Proteintech is a Polyclonal antibody targeting CRTAM/CD355 in WB, ELISA applications with reactivity to mouse, rat samples 16627-1-AP targets CRTAM/CD355 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse thymus tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Cytotoxic and regulatory T cell molecule (CRTAM, also known as CD355) is an immunoglobulin-superfamily transmembrane protein with V and C1-like Ig domains, which is involved in epithelial cell adhesion (PMID: 18329370; 20556794). CRTAM is critical to instruct the differentiation of CD4+ cytotoxic T cells (CTL) through the induction of eomesodermin and CTL-related genes (PMID: 26694968). It also regulates CD8+ T cell retention within the lymph node and eventually effector function (PMID: 19752223). The predicted molecular weight of CRTAM is 43 kDa. Due to glycosylation, the observed molecular weight of CRTAM can be apparent at ~80 kDa (PMID: 16300832). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag9956 Product name: Recombinant human CRTAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-292 aa of BC070266 Sequence: NHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPVLKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSGILLLT Predict reactive species Full Name: cytotoxic and regulatory T cell molecule Calculated Molecular Weight: 393 aa, 45 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC070266 Gene Symbol: CRTAM Gene ID (NCBI): 56253 RRID: AB_3085502 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95727 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924