Proteintech, 16645-1-AP, ASL Polyclonal antibody

Size: 20ul / 150ul The ASL (16645-1-AP) by Proteintech is a Polyclonal antibody targeting ASL in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 16645-1-AP targets ASL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse liver tissue, rat kidney tissue, rat liver tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Background Information Argininosuccinate lyase (ASL), one of the significant UC enzymes, catalyzes argininosuccinate cleavage to generate arginine and fumarate. Arginine is then catalyzed by arginase to ornithine and polyamines, which are found to promote cancer cell proliferation and growth. Importantly, ASL ectopic expression is closely associated with poor prognosis of colorectal cancer, hepatocellular. ASL is a member of the aspartase/fumarase superfamily. Enzymes of this superfamily share similar tetrameric structure and active site, though the sequence identities between different members are quite low (less than 20%). Members of this superfamily have been recognised as drug targets for microbial infections. ASL is a 464-amino-acid enzyme with a molecular mass of 49.7 kDa. (PMID: 22386318 PMID: 31018905) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10007 Product name: Recombinant human ASL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 114-464 aa of BC008195 Sequence: NDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLGVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHQENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNQLSLQELQTISPLFSGDVICVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQAQQA Predict reactive species Full Name: argininosuccinate lyase Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC008195 Gene Symbol: ASL Gene ID (NCBI): 435 RRID: AB_2878293 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04424 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.