Proteintech, 16667-1-AP, IYD Polyclonal antibody

Size: 20ul / 150ul The IYD (16667-1-AP) by Proteintech is a Polyclonal antibody targeting IYD in WB, ELISA applications with reactivity to human samples 16667-1-AP targets IYD in WB, IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information IYD(Iodotyrosine dehalogenase 1) is also named as C6orf71, DEHAL1 and belongs to the nitroreductase family. It is a transmembrane protein that deiodinates mono-and di-iodotyrosines (MIT, DIT) and recycles iodine, a scarce element in the environment, for the efficient synthesis of thyroid hormone. This protein has 6 isoforms produced by alternative splicing. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag10146 Product name: Recombinant human IYD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-289 aa of BC056253 Sequence: EPRTRAEARPWVDEDLKDSSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTPLNCGPRLRVLLGRPAHEKLPMLLPVGYPSKEATVPDLKRKPLDQIMVTV Predict reactive species Full Name: iodotyrosine deiodinase Calculated Molecular Weight: 289 aa, 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC056253 Gene Symbol: IYD Gene ID (NCBI): 389434 RRID: AB_1851260 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6PHW0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.